PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_003759-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 183aa    MW: 21185.7 Da    PI: 8.6187
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_003759-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.9e-172166148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg +++eE++l+++ +k+lG++ W++Ia +++ gRt++++k++w+++l
    NNU_003759-RA 21 RGGMSEEEEDLIIRMHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNTHL 66
                     6789******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.461115IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.2E-9229IPR009057Homeodomain-like
SuperFamilySSF466895.56E-19268IPR009057Homeodomain-like
PROSITE profilePS5129424.3211670IPR017930Myb domain
SMARTSM007173.9E-162068IPR001005SANT/Myb domain
PfamPF002491.7E-152166IPR001005SANT/Myb domain
CDDcd001674.08E-132466No hitNo description
Gene3DG3DSA:1.10.10.601.2E-213066IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MREGKSCRLR WKNYLRPNLK RGGMSEEEED LIIRMHKLLG NRWSLIAGRL PGRTDNEIKN  60
YWNTHLIKRY PQCKRVDQSN SKRRKLSHST NDRPICSGTT HSTTKKSDDE GGKNSTTVPN  120
DTKSGNHDVE SHHLSAYQGT FFEDAFLPPL DSVVLFDSFG CSSESSWTEF HFYFPEEMYP  180
VLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-1926940106B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010250168.11e-136PREDICTED: transcription factor MYB114-like
SwissprotQ9LTF72e-39MYB82_ARATH; Transcription factor MYB82
TrEMBLB9HA936e-48B9HA93_POPTR; Uncharacterized protein
TrEMBLF6HHA74e-48F6HHA7_VITVI; Putative uncharacterized protein
STRINGVIT_11s0016g05690.t011e-47(Vitis vinifera)
STRINGPOPTR_0006s06530.12e-47(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52600.11e-40myb domain protein 82